Bacterial taxon 909946
Locus STM474_3679
Protein WP_000619387.1
iron-sulfur cluster biogenesis protein NfuA
Salmonella enterica Serovar Typhimurium ST4 74
Length 191 aa, Gene yhgI, UniProt E8XEL5
>WP_000619387.1|Salmonella enterica Serovar Typhimurium ST4 74|iron-sulfur cluster biogenesis protein NfuA
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYALQSQINPQLAGHGGRVSLMEITDEGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,691,078 | -6.43 | 2.5e-8 | ●●●●○ -3.16 | -3.15956984757032 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,691,078 | -3.39 | 0.00039 | ●●○○○ -1.58 | -1.5822190714332 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,691,078 | -1.22 | 0.12 | ●○○○○ -0.45 | -0.454751634849075 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)