Bacterial taxon 909946
Locus STM474_3487
Protein WP_000719822.1
isoprenoid biosynthesis glyoxalase ElbB
Salmonella enterica Serovar Typhimurium ST4 74
Length 217 aa, Gene yhbL, UniProt E8XD30
>WP_000719822.1|Salmonella enterica Serovar Typhimurium ST4 74|isoprenoid biosynthesis glyoxalase ElbB
MKKIGVVLSGCGVYDGTEIHEAVLTLLAIARSGAQAVCFAPDKPQADVINHLTGEAMAETRNVLIEAARITRGDIRPLSQAQPEELDALIVPGGFGAAKNLSNFASQGSECRVDSDVVALAKAMHQSGKPLGFICIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVVDEDNKVVTTPAYMLAQDIAQAASGIDKLVSRVLVLAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,511,190 | 1.57 | 0.0091 | ○○○○○ 0.99 | 0.993197255334811 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,511,664 | 0.03 | 0.97 | ○○○○○ 0.19 | 0.190924052937028 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,511,664 | 0.88 | 0.78 | ○○○○○ 0.64 | 0.635614197488935 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,511,190 | 1.67 | 0.37 | ○○○○○ 1.04 | 1.04453232577634 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,511,190 | 2.04 | 0.22 | ○○○○○ 1.24 | 1.23881754322985 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,511,664 | 2.06 | 0.3 | ○○○○○ 1.25 | 1.24920684710693 | 23637626 |
Retrieved 6 of 6 entries in 11.8 ms
(Link to these results)