Bacterial taxon 909946
Locus STM474_4533
Protein WP_000239598.1
lipoprotein toxin entericidin B
Salmonella enterica Serovar Typhimurium ST4 74
Length 48 aa, Gene ecnB, UniProt E8XAL5
>WP_000239598.1|Salmonella enterica Serovar Typhimurium ST4 74|lipoprotein toxin entericidin B
MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGSAISGAATRAQQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,601,168 | 1.83 | 0.015 | ○○○○○ 1.13 | 1.12578045652646 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,601,168 | -0.55 | 0.84 | ●○○○○ -0.11 | -0.106387572436496 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,601,168 | 0.59 | 0.63 | ○○○○○ 0.48 | 0.483126728101679 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)