Bacterial taxon 909946
Locus STM474_0609
Protein WP_001139583.1
LPS O-antigen length regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 378 aa, Gene fepE, UniProt E8X960
>WP_001139583.1|Salmonella enterica Serovar Typhimurium ST4 74|LPS O-antigen length regulator
MPSLNVKQEKNQSFAGYSLPPANSHEIDLFSLIEVLWQAKRRILATVFAFACVGLLLSFLLPQKWTSQAIVTPAESVQWQGLERTLTALRVLDMEVSVDRGSVFNLFIKKFSSPSLLEEYLRSSPYVMDQLKGAQIDEQDLHRAIVLLSEKMKAVDSNVGKKNETSLFTSWTLSFTAPTREEAQKVLAGYIQYISDIVVKETLENIRNQLEIKTRYEQEKLAMDRVRLKNQLDANIQRLHYSLEIANAAGIKRPVYSNGQAVKDDPDFSISLGADGISRKLEIEKGVTDVAEIDGDLRNRQYHVEQLAAMNVSDVKFTPFKYQLSPSLPVKKDGPGKAIIIILAALIGGMMACGGVLLHHAMVSRKMENALAIDERLV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 649,329 | -6.59 | 1.3e-5 | ●●●●○ -3.25 | -3.24580964649241 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 649,329 | -5.21 | 1.2e-5 | ●●●○○ -2.53 | -2.5304766308386 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 649,248 | -4.81 | 1.9e-17 | ●●●○○ -2.32 | -2.32160428399673 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 649,329 | -4.72 | 4.1e-16 | ●●●○○ -2.27 | -2.27421154297414 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 649,248 | -2.78 | 0.0041 | ●●○○○ -1.27 | -1.26859418204494 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 649,601 | -1.24 | 0.0065 | ●○○○○ -0.47 | -0.467580071693831 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 649,248 | -2.16 | 0.064 | ●○○○○ -0.95 | -0.945442850963472 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 650,219 | -0.26 | 0.72 | ○○○○○ 0.04 | 0.0434469283564131 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 650,157 | 0.47 | 0.73 | ○○○○○ 0.42 | 0.42016216894681 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 650,219 | 0.69 | 0.62 | ○○○○○ 0.53 | 0.533453208858495 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 650,219 | 0.69 | 0.85 | ○○○○○ 0.54 | 0.535288445276286 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 650,157 | 1.04 | 0.058 | ○○○○○ 0.72 | 0.718925610811588 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 649,601 | 1.49 | 0.75 | ○○○○○ 0.95 | 0.952940340015691 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 650,157 | 1.89 | 0.47 | ○○○○○ 1.16 | 1.16026955094962 | 23637626 |
Retrieved 14 of 14 entries in 24.7 ms
(Link to these results)