Bacterial taxon 909946
Locus STM474_4623
Protein WP_000678386.1
lysosomal glucosyl ceramidase-like type III secretion effector SrfJ
Salmonella enterica Serovar Typhimurium ST4 74
Length 447 aa, Gene srfJ, UniProt E8XBH9
>WP_000678386.1|Salmonella enterica Serovar Typhimurium ST4 74|lysosomal glucosyl ceramidase-like type III secretion effector SrfJ
MKGRLISSDPYRQQFLVERAVSFSHRQRDCSELISVLPRHALQQIDGFGGSFTEGAGVVFNSMSEKTKAQFLSLYFSAQEHNYTLARMPIQSCDFSLGNYAYVDSSADLQQGRLSFSRDEAHLIPLISGALRLNPHMKLMASPWSPPAFMKTNNDMNGGGKLRRECYADWADIIINYLLEYRRHGINVQALSVQNEPVAVKTWDSCLYSVEEETAFAVQYLRPRLARQGMDEMEIYIWDHDKDGLVDWAELAFADEANYKGINGLAFHWYTGDHFSQIQYLAQCLPDKKLLFSEGCVPMESDAGSQIRHWHTYLHDMIGNFKSGCSGFIDWNLLLNSEGGPNHQGNLCEAPIQYDAQNDVLRRNHSWYGIGHFCRYVRPGARVMLSSSYDNLLEEVGFVNPDGERVLVVYNRDVQERRCRVLDGDKEIALTLPPSGASTLLWRQESI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,689,689 | -2.33 | 1.1e-5 | ●●○○○ -1.03 | -1.03427859408818 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,689,689 | -0.62 | 0.62 | ●○○○○ -0.14 | -0.143742350399511 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,689,778 | -0.09 | 0.95 | ○○○○○ 0.13 | 0.128496115187012 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,689,689 | 0.12 | 1 | ○○○○○ 0.24 | 0.236887167267143 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,689,778 | 0.48 | 0.92 | ○○○○○ 0.43 | 0.428351680067543 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,689,778 | 0.72 | 0.35 | ○○○○○ 0.55 | 0.550231467275683 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)