Bacterial taxon 909946
Locus STM474_0267
Protein WP_000648534.1
LysR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 304 aa, Gene yafC, UniProt E8XIS1
>WP_000648534.1|Salmonella enterica Serovar Typhimurium ST4 74|LysR family transcriptional regulator
MKATSEELAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLEMKLGVSLLNRTTRQLSLTEEGERYFRRVQQILQEMAAAETEIMESRNTPRGLLRIDAATPVMLHFLMPLIKPFRERYPEITLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLFTSYRKIIASPDYIARFGKPETVEELKRHLCLGFSEPVSLNTWPIACSDGQLHEIKCGISSNSGETLKQLCLNGNGIACLSDYMIDKEIARGELVELLADKRLPVEMPFSAVYYSDRAVSTRIRAFIDFLSEYIRTAPAGAVKEG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 296,262 | 2.01 | 0.0073 | ○○○○○ 1.22 | 1.21909461142627 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 296,295 | -0.83 | 0.25 | ●○○○○ -0.25 | -0.25230968334285 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 296,262 | -0.01 | 1 | ○○○○○ 0.17 | 0.172076606819603 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 296,723 | 0.14 | 0.93 | ○○○○○ 0.25 | 0.249230091065452 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 296,723 | 0.47 | 0.92 | ○○○○○ 0.42 | 0.423237118663093 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 296,295 | 0.52 | 0.97 | ○○○○○ 0.44 | 0.444725933961226 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 296,262 | 0.52 | 0.7 | ○○○○○ 0.45 | 0.449430388374868 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 296,262 | 0.76 | 0.83 | ○○○○○ 0.57 | 0.569331697623964 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 296,723 | 0.95 | 0.14 | ○○○○○ 0.67 | 0.672812228612025 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 296,262 | 1.21 | 0.62 | ○○○○○ 0.8 | 0.804812269490657 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 296,295 | 1.85 | 0.28 | ○○○○○ 1.14 | 1.1378314065277 | 23637626 |
Retrieved 11 of 11 entries in 2.7 ms
(Link to these results)