Bacterial taxon 909946
Locus STM474_4466
Protein WP_000354963.1
LysR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 295 aa, Gene n/a, UniProt E8X9S1
>WP_000354963.1|Salmonella enterica Serovar Typhimurium ST4 74|LysR family transcriptional regulator
MDIRTLRYFVEVVRQQSFTRAAEKLFVTQPTISKMLKNLEDELNCTLLIRDGRKLLLTDTGRVVFERGLAILAEFRQLEAELSDINHLNKGVLRLGIPPMVGMLMAGPISLFRQRYPGVELKISEFGGLTVQQAVMNGELDVAMTALPVEEASGLTTLSLFSHPLCVLVPRSGQWTTGDSIAPEALAEHPLLIYNEDFALSRQLMTLFSQHDVKPRIAVRSGQWDFLAAMVQAGVGIAILPEPICQRLDKATLRWLPLESDLRWQLGMIWREGVYLSHSARAWLTCCEGFWLKQP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,530,814 | 1.31 | 0.02 | ○○○○○ 0.86 | 0.859871654279554 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,530,997 | 2.38 | 0.0019 | ○○○○○ 1.41 | 1.414429413788 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,531,172 | -0.69 | 0.81 | ●○○○○ -0.18 | -0.179850525315611 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,531,373 | -0.25 | 0.96 | ○○○○○ 0.05 | 0.0492713384583557 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,531,172 | -0.15 | 0.82 | ○○○○○ 0.1 | 0.0982379816702941 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,530,814 | 0.03 | 1 | ○○○○○ 0.19 | 0.191318441829133 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,530,814 | 0.13 | 0.88 | ○○○○○ 0.24 | 0.243964379995156 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,530,814 | 0.13 | 1 | ○○○○○ 0.24 | 0.244501053850796 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,530,997 | 0.5 | 0.91 | ○○○○○ 0.44 | 0.43647161495971 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,530,814 | 0.64 | 0.62 | ○○○○○ 0.51 | 0.511656770214135 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,531,147 | 0.71 | 0.85 | ○○○○○ 0.55 | 0.547207845068619 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,531,147 | 0.72 | 0.57 | ○○○○○ 0.55 | 0.549236152313909 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,530,997 | 0.74 | 0.67 | ○○○○○ 0.56 | 0.559683206584698 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,531,373 | 0.79 | 0.75 | ○○○○○ 0.59 | 0.58744546109471 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,531,147 | 1.22 | 0.1 | ○○○○○ 0.81 | 0.8082234718545 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,530,814 | 1.73 | 0.38 | ○○○○○ 1.07 | 1.07339837230391 | 23637626 |
Retrieved 16 of 16 entries in 0.7 ms
(Link to these results)