Bacterial taxon 909946
Locus STM474_3268
Protein WP_001094307.1
MaoC family dehydratase
Salmonella enterica Serovar Typhimurium ST4 74
Length 175 aa, Gene n/a, UniProt E8XAG8
>WP_001094307.1|Salmonella enterica Serovar Typhimurium ST4 74|MaoC family dehydratase
MNTLLPAYKTISEGRYREISGLYWEDFHPGDVFEHRPGRTVLDADNVWFTLLTLNVQPVHFDAAYASKTEWKKLLVDSTFTLALLTGMSVRTVSAKVVANLGWDKVQAVHPVFAGDTLYAESTVLSKRLSNSRPGQGIVTVRTCGINQNGVEVMRFERTMLVYCCGCSPEEDAAY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,298,919 | -2.95 | 4.1e-5 | ●●○○○ -1.35 | -1.35327148189036 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,298,919 | -1.44 | 0.31 | ●○○○○ -0.57 | -0.569179679032083 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,299,005 | -0.26 | 0.86 | ○○○○○ 0.04 | 0.0420060647319706 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,299,005 | -0.25 | 0.94 | ○○○○○ 0.05 | 0.0478985569940216 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,298,919 | 0.78 | 0.82 | ○○○○○ 0.58 | 0.58283331071846 | 23637626 |
Retrieved 5 of 5 entries in 2.5 ms
(Link to these results)