Bacterial taxon 909946
Locus STM474_1937
Protein WP_000252975.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 131 aa, Gene yecN, UniProt E8X9H1
>WP_000252975.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MVSALYAVLGALLLMKFSFNVVRLRMQYRVAYGDGGFSELQSAIRIHGNAVEYIPVALVLLLFMEMNGAETWMVHICGIILIAGRLMHYYGFHHRLFRWRRAGMSATWCALLLMVLANLWYMPWELVFSLY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,956,485 | 1.91 | 0.014 | ○○○○○ 1.17 | 1.16915127743645 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,956,433 | -0.31 | 0.86 | ○○○○○ 0.02 | 0.0179319766294459 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,956,433 | -0.08 | 0.98 | ○○○○○ 0.13 | 0.133652368735321 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,956,485 | -0.07 | 0.98 | ○○○○○ 0.14 | 0.140242954486809 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,956,433 | 0.43 | 0.88 | ○○○○○ 0.4 | 0.402849575148178 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,956,485 | 1.92 | 0.1 | ○○○○○ 1.17 | 1.17421219622665 | 23637626 |
Retrieved 6 of 6 entries in 2.2 ms
(Link to these results)