Bacterial taxon 909946
Locus STM474_3041
Protein WP_000381610.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 149 aa, Gene n/a, UniProt E8XL29
>WP_000381610.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MDTTEELNGTYFYHGQSNLSAGELFDVIFIEQFCDELGIGIESGAAILAGQPWLKTRTKPGEAIKGTSVISRYGRMLLRNARTPFGIRVPTPVGIRMRKTNNLAAVIARYVPWLGWVGLVNSIYQVSRRTQAKYNLIARPKDRIQWTSF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,067,961 | -5.94 | 5.2e-34 | ●●●○○ -2.91 | -2.90962455710439 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,067,961 | -5.64 | 1.4e-6 | ●●●○○ -2.75 | -2.75135265861704 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,067,977 | -3.83 | 1.7e-7 | ●●○○○ -1.81 | -1.81294388526551 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,068,270 | -3.29 | 0.0004 | ●●○○○ -1.53 | -1.53156363440068 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,068,045 | -3 | 0.00076 | ●●○○○ -1.38 | -1.38276331096748 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,068,270 | -2.77 | 1.7e-7 | ●●○○○ -1.26 | -1.2589636286555 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,067,961 | -2.44 | 0.043 | ●●○○○ -1.09 | -1.08969103602974 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,068,242 | -2.04 | 0.025 | ●○○○○ -0.88 | -0.884600212803014 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,068,270 | -1.84 | 0.15 | ●○○○○ -0.78 | -0.776346463380972 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,067,977 | -1.61 | 0.11 | ●○○○○ -0.66 | -0.658169842986076 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,068,045 | -0.18 | 0.83 | ○○○○○ 0.08 | 0.0829230861878976 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,068,059 | -0.16 | 0.93 | ○○○○○ 0.1 | 0.0964514502223747 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,068,159 | -0.13 | 0.97 | ○○○○○ 0.11 | 0.108466768482568 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,068,059 | 0.11 | 1 | ○○○○○ 0.23 | 0.233406178871588 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,068,159 | 0.29 | 0.72 | ○○○○○ 0.33 | 0.3282404983119 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,068,057 | 0.34 | 0.95 | ○○○○○ 0.35 | 0.35357594942438 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,067,977 | 0.38 | 0.94 | ○○○○○ 0.37 | 0.37266214996612 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,068,242 | 0.41 | 0.94 | ○○○○○ 0.39 | 0.388024748140973 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,068,045 | 1.05 | 0.86 | ○○○○○ 0.72 | 0.724090354116979 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,068,059 | 1.06 | 0.15 | ○○○○○ 0.73 | 0.729110767397458 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,068,057 | 1.45 | 0.059 | ○○○○○ 0.93 | 0.930380369553037 | 23637626 |
Retrieved 21 of 21 entries in 1.2 ms
(Link to these results)