Bacterial taxon 909946
Locus STM474_4283
Protein WP_000852810.1
met regulon transcriptional regulator MetJ
Salmonella enterica Serovar Typhimurium ST4 74
Length 105 aa, Gene metJ, UniProt E8XKG8
>WP_000852810.1|Salmonella enterica Serovar Typhimurium ST4 74|met regulon transcriptional regulator MetJ
MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMRELGIDPETWEY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,330,764 | -6.27 | 6.1e-8 | ●●●●○ -3.08 | -3.08068565613196 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,330,764 | -2.31 | 0.013 | ●●○○○ -1.02 | -1.02279362027579 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,330,764 | -0.78 | 0.14 | ●○○○○ -0.23 | -0.23014166255105 | 23637626 |
Retrieved 3 of 3 entries in 34.8 ms
(Link to these results)