Bacterial taxon 909946
Locus STM474_4010
Protein WP_000061259.1
MFS transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 420 aa, Gene n/a, UniProt E8XHR9
>WP_000061259.1|Salmonella enterica Serovar Typhimurium ST4 74|MFS transporter
MSMALTAPPTRKRFLIVACLFIGIFIAYLDRVNVSVLAANEPFLAYMGIEGMPLQIGMMMTVFLAAYGIANVVLSPLGDYLGPRKAMMLCILIWTIALMIGGVATSFALIIICRILLGIGEGFYYPLQSVFIKNWFPKQERGRANAAWIVGQSVAPAIAMPFFTWWIGTHGWRSNFFLCAALGLIPLWLLWRYVADKPEQHKSISEQELAYIKAGQETESAGSSESFMLRVKPVITNYSYWLLVLWYLCLQCLYWGMITWLPTYLKSARGFSWAEMGWLASLPFVLSIFAKAAAGVFVDKIGRSAPILMVLMFFAGVSIYFGTITEHKYMSAVLLSFAVAFCTMGTPVAWTLLQGMIPGKSISAASGVMNGVANGLSSLSPVFIGLFISITGTYTGGLLCLVFISAIAVVSALILTIKKY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,057,851 | -5.47 | 3.7e-18 | ●●●○○ -2.66 | -2.66377161102056 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,057,666 | -4.59 | 0.00015 | ●●●○○ -2.21 | -2.20585767220984 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,057,666 | -3.84 | 3.1e-24 | ●●○○○ -1.82 | -1.8174974860227 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,057,097 | -2.7 | 0.0042 | ●●○○○ -1.22 | -1.22376444249555 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,057,097 | -2.49 | 0.027 | ●●○○○ -1.11 | -1.11366393358134 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,057,851 | -2.06 | 0.073 | ●○○○○ -0.89 | -0.893927045496364 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,057,666 | -1.96 | 0.12 | ●○○○○ -0.84 | -0.839803771194314 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,057,851 | -1.43 | 0.62 | ●○○○○ -0.57 | -0.56532295968377 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,057,113 | -0.74 | 0.13 | ●○○○○ -0.21 | -0.205332632982959 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,057,097 | -0.63 | 0.36 | ●○○○○ -0.15 | -0.148438276626781 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,057,113 | -0.53 | 0.68 | ●○○○○ -0.1 | -0.0959025074439145 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,057,113 | 0.24 | 0.97 | ○○○○○ 0.3 | 0.304145312010148 | 23637626 |
Retrieved 12 of 12 entries in 142.3 ms
(Link to these results)