Bacterial taxon 909946
Locus STM474_3859
Protein WP_000193201.1
MltR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 196 aa, Gene mtlR, UniProt E8XG01
>WP_000193201.1|Salmonella enterica Serovar Typhimurium ST4 74|MltR family transcriptional regulator
MTQNPAQVSLRPNNRLSDMQAIMEQTQAFENRVLERLNAGKTVRSFLITAVELLTEAVNILVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVLSRTEYEDAELLMALREELNHDGNEYAFTDDEILGPFGELHCVMALPPPPHFDTSDAALYAMQIQRYQQAVRSTMVLSLTELISKISLKKAFQK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,900,405 | -4.36 | 7.6e-16 | ●●●○○ -2.09 | -2.08611895209129 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,900,405 | -1.62 | 0.22 | ●○○○○ -0.66 | -0.664086987118 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,900,405 | -1.25 | 0.23 | ●○○○○ -0.47 | -0.471861853258327 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)