Bacterial taxon 909946
Locus STM474_4504
Protein WP_001112218.1
molecular chaperone
Salmonella enterica Serovar Typhimurium ST4 74
Length 217 aa, Gene n/a, UniProt E8X9V9
>WP_001112218.1|Salmonella enterica Serovar Typhimurium ST4 74|molecular chaperone
MPCKPDQRSVIRRNISGAIAMLSRAVLPRILGALFYYSPERPEVKALFDCLPTLPELYPWRDRGSIESLCASWSLPDDDALTWQFSVLFEGQGKMPVPPWGSVYLEKDNLLMGETTADYRAFLQSQGMVFTDREREPEDQFGLMLLACSDLLARGDNVAANRLLEAHLLPWGFRYLELLQRNTVSAFYARLAVVATCYLQDVQQQQGLQPENKRLFF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,577,492 | -3.13 | 2.3e-7 | ●●○○○ -1.45 | -1.44668804669206 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,577,492 | -0.21 | 0.97 | ○○○○○ 0.07 | 0.0705523260818372 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,577,492 | 0.26 | 0.73 | ○○○○○ 0.31 | 0.312538224166837 | 23637626 |
Retrieved 3 of 3 entries in 92 ms
(Link to these results)