Bacterial taxon 909946
Locus STM474_0234
Protein WP_000758966.1
molecular chaperone Skp
Salmonella enterica Serovar Typhimurium ST4 74
Length 161 aa, Gene hlpA, UniProt E8XI23
>WP_000758966.1|Salmonella enterica Serovar Typhimurium ST4 74|molecular chaperone Skp
MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNTLENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFEKDRARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 264,994 | -9.59 | 1.1e-10 | ●●●●● -4.8 | -4.80137978984807 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 264,994 | -4.26 | 5.2e-5 | ●●●○○ -2.04 | -2.03616590380027 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 264,994 | -1.05 | 0.043 | ●○○○○ -0.37 | -0.367301284227417 | 23637626 |
Retrieved 3 of 3 entries in 31 ms
(Link to these results)