Bacterial taxon 909946
Locus STM474_0831
Protein WP_000545202.1
molybdopterin synthase catalytic subunit MoaE
Salmonella enterica Serovar Typhimurium ST4 74
Length 150 aa, Gene moaE, UniProt E8XBR9
>WP_000545202.1|Salmonella enterica Serovar Typhimurium ST4 74|molybdopterin synthase catalytic subunit MoaE
MHETRIVVGPAPFSVGEEYSWLAARDEDGAVVTFTGKVRNHNLGDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGDRWVEARDSDQQLAKRW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 872,277 | 1.6 | 0.0014 | ○○○○○ 1.01 | 1.00644438551999 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 872,423 | -2.49 | 0.82 | ●●○○○ -1.11 | -1.11344654116814 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 872,277 | -2.09 | 0.074 | ●○○○○ -0.91 | -0.906181370048512 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 872,423 | 0.15 | 0.89 | ○○○○○ 0.25 | 0.254480891571439 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 872,277 | 0.16 | 0.91 | ○○○○○ 0.26 | 0.258626249677671 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 872,423 | 1.04 | 0.062 | ○○○○○ 0.72 | 0.718700679506554 | 23637626 |
Retrieved 6 of 6 entries in 21.2 ms
(Link to these results)