Bacterial taxon 909946
Locus STM474_3435
Protein WP_000532745.1
murein L,D-transpeptidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 239 aa, Gene n/a, UniProt E8XC94
>WP_000532745.1|Salmonella enterica Serovar Typhimurium ST4 74|murein L,D-transpeptidase
MGRKGLLAIVLLSLFIAFILKFFWLTPYDEDVYLPVEKPVASSLKIIHPGDQLFIRILKAEDKLELWASANNKPYKLYKTWTICAWSGGLGPKHKQGDGKSPEGFYATNKGLLNPNSRYHLAFNIGYPNAYDRANGYTGDFIMVHGNCVSAGCYAMTDAGIEEIYQLVAQALNSGQKSVPVHIFPFTMNDENMRQAQAWPEYNFWRMLKPGYDYFEKNRRLPTITVENRRYKISPTTLP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,464,509 | -7.44 | 1.6e-26 | ●●●●○ -3.69 | -3.68809315679197 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,464,509 | -6.17 | 1.2e-8 | ●●●●○ -3.02 | -3.0247041818344 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,464,509 | -2.17 | 0.06 | ●○○○○ -0.95 | -0.950738228925915 | 23637626 |
Retrieved 3 of 3 entries in 70.9 ms
(Link to these results)