Bacterial taxon 909946
Locus STM474_3815
Protein WP_000619902.1
N-acetyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 146 aa, Gene yiac, UniProt E8XFV8
>WP_000619902.1|Salmonella enterica Serovar Typhimurium ST4 74|N-acetyltransferase
MIRKSQSEDMASILALWMKSTIYAHPFIEERYWHESEAIVRDVYLPAAQTWVWEENGQLKGFVSVLEARFVGALFVAPDALRHGIGKALLEYVQQRFPLLSLEVYQKNQSAVNFYHALGFRIEDSAWQEDTAHPTWIMSWQADQTP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,851,248 | 2.1 | 0.0078 | ○○○○○ 1.27 | 1.26739114338396 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,851,248 | -2.9 | 0.73 | ●●○○○ -1.33 | -1.32898162475245 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,851,248 | 0.55 | 0.75 | ○○○○○ 0.46 | 0.46467662369987 | 23637626 |
Retrieved 3 of 3 entries in 2.2 ms
(Link to these results)