Bacterial taxon 909946
Locus STM474_2417
Protein WP_000393522.1
NADH-quinone oxidoreductase subunit J
Salmonella enterica Serovar Typhimurium ST4 74
Length 184 aa, Gene nuoJ, UniProt E8XEG3
>WP_000393522.1|Salmonella enterica Serovar Typhimurium ST4 74|NADH-quinone oxidoreductase subunit J
MEFAFYICGLIAILATLRVITHTNPVHALLYLVISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAVLSAIMLAVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRADDRAKRKTEERA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,427,798 | -4.76 | 0.00032 | ●●●○○ -2.3 | -2.29523596679422 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,427,798 | -4.69 | 9.4e-34 | ●●●○○ -2.26 | -2.25662180337171 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,427,798 | -1.91 | 0.21 | ●○○○○ -0.81 | -0.813406221766072 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)