Bacterial taxon 909946
Locus STM474_4239
Protein WP_000133444.1
nuclear transport factor 2 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 131 aa, Gene n/a, UniProt E8XKC4
>WP_000133444.1|Salmonella enterica Serovar Typhimurium ST4 74|nuclear transport factor 2 family protein
MTEAENAVAIVKEFLVASMIPDAERAATYMHPEVKITFTGGRAMAGAADIAQFNGARYKWVKKALGEFDAVQHDHYVVIYSNGTLYGEWPDGRPFAGNRFIDRFEVRDGKITRMDVWNDSAEWILVPEISR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,289,528 | 1.57 | 0.033 | ○○○○○ 0.99 | 0.992534586379849 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,289,528 | 0.2 | 0.98 | ○○○○○ 0.28 | 0.27895410627428 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,289,471 | 0.36 | 0.68 | ○○○○○ 0.36 | 0.362768889280109 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,289,457 | 0.42 | 0.77 | ○○○○○ 0.39 | 0.39318050885961 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,289,528 | 0.62 | 0.38 | ○○○○○ 0.5 | 0.50088536443128 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,289,457 | 0.69 | 0.85 | ○○○○○ 0.54 | 0.536849211399727 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,289,471 | 0.71 | 0.65 | ○○○○○ 0.55 | 0.546403495113144 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,289,528 | 0.77 | 0.82 | ○○○○○ 0.58 | 0.577227929390416 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,289,471 | 1.21 | 1 | ○○○○○ 0.8 | 0.804873877354121 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,289,528 | 1.37 | 0.56 | ○○○○○ 0.89 | 0.887409607413291 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,289,457 | 1.42 | 0.061 | ○○○○○ 0.92 | 0.915766137129324 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,289,528 | 1.7 | 0.33 | ○○○○○ 1.06 | 1.05745875938647 | 23637626 |
Retrieved 12 of 12 entries in 2.8 ms
(Link to these results)