Bacterial taxon 909946
Locus STM474_2726
Protein WP_000211410.1
ORF6N domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 187 aa, Gene n/a, UniProt E8XHJ8
>WP_000211410.1|Salmonella enterica Serovar Typhimurium ST4 74|ORF6N domain-containing protein
MTTQISVETLSPITHNQIPVITTELLAHLYGTKIKNISDNFLNNTTRFVVGKHFFKIEKNELREFKNRPETIGLVGKNARSLILWTERGAARHAKMLETDQAWEVFEKLEDCYFSQTLPSPTRQVQPAVDMLNIDLLIKIRDGNVKDIRQVGPDMFVGKVEQILSGLRDSGWIVIKRDLLAEKLATW
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,760,072 | -2.08 | 0.022 | ●○○○○ -0.9 | -0.903817092143558 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,760,072 | -2 | 0.00082 | ●○○○○ -0.86 | -0.862317663900277 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,760,072 | 0.51 | 0.97 | ○○○○○ 0.44 | 0.441184368541931 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)