Bacterial taxon 909946
Locus STM474_2808
Protein WP_001203445.1
outer membrane protein assembly factor BamE
Salmonella enterica Serovar Typhimurium ST4 74
Length 112 aa, Gene bamE, UniProt E8XIG2
>WP_001203445.1|Salmonella enterica Serovar Typhimurium ST4 74|outer membrane protein assembly factor BamE
MRCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTPTDVAKVRVGMTQQQVAYALGTPMMTDPFGTNTWFYVFRQQPGHENVTQQTLTLTFNSSGVLTNIDNKPALTK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,836,330 | -4.93 | 4.8e-18 | ●●●○○ -2.38 | -2.38079932297696 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,836,330 | -3.46 | 0.0015 | ●●○○○ -1.62 | -1.61873438701442 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,836,376 | -2.97 | 0.0081 | ●●○○○ -1.36 | -1.36350459043975 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,836,376 | -2.13 | 0.0034 | ●○○○○ -0.93 | -0.928137731661639 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,836,376 | -1.5 | 0.0039 | ●○○○○ -0.6 | -0.602814461268958 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,836,330 | -2.02 | 0.095 | ●○○○○ -0.87 | -0.869410221339708 | 23637626 |
Retrieved 6 of 6 entries in 3.7 ms
(Link to these results)