Bacterial taxon 909946
Locus STM474_2534
Protein WP_000487600.1
phosphocarrier protein Hpr
Salmonella enterica Serovar Typhimurium ST4 74
Length 85 aa, Gene ptsH, UniProt E8XFP0
>WP_000487600.1|Salmonella enterica Serovar Typhimurium ST4 74|phosphocarrier protein Hpr
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,542,461 | -5.32 | 2.5e-10 | ●●●○○ -2.58 | -2.58407565537043 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,542,461 | -3.91 | 0.0003 | ●●○○○ -1.85 | -1.85258546820525 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,542,461 | -1.4 | 0.0079 | ●○○○○ -0.55 | -0.549553165277128 | 23637626 |
Retrieved 3 of 3 entries in 2.4 ms
(Link to these results)