Bacterial taxon 909946
Locus STM474_2122
Protein WP_001000023.1
propanediol diffusion facilitator PduF
Salmonella enterica Serovar Typhimurium ST4 74
Length 264 aa, Gene pduF, UniProt E8XBZ1
>WP_001000023.1|Salmonella enterica Serovar Typhimurium ST4 74|propanediol diffusion facilitator PduF
MNDSLKAQCGAEFLGTGLFLFFGIGCLSALKVAGASLGLWEICIIWGLGISLAVYLTAGISGGHLNPAVTIALWLFACFPKQKVLPYIIAQFAGAFGGALLAYVLYSSLFTEFETAHHMVRGSVESLQLASIFSTYPAAALNVWQAALVEVVITSILMGMIMALTDDGNGIPKGPLAPLLIGILVAVIGASTGPLTGFAMNPARDFGPKLFTWLAGWGNMAMSGGREIPYFIVPIVAPVIGACAGAAIYRYFIGKNLPCNRCEL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,113,736 | -7.19 | 3.1e-22 | ●●●●○ -3.56 | -3.55632854308823 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,113,736 | -3.52 | 0.0083 | ●●○○○ -1.65 | -1.64953232377729 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,113,388 | -1.45 | 0.0065 | ●○○○○ -0.58 | -0.575095806865095 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,113,736 | -4.01 | 0.37 | ●●○○○ -1.9 | -1.90340056283672 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,113,388 | -1.7 | 0.28 | ●○○○○ -0.71 | -0.706455645901601 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,113,388 | 0.24 | 0.99 | ○○○○○ 0.3 | 0.302931231047724 | 23637626 |
Retrieved 6 of 6 entries in 75.6 ms
(Link to these results)