Bacterial taxon 909946
Locus STM474_2131
Protein WP_001284387.1
propanediol utilization microcompartment protein PduK
Salmonella enterica Serovar Typhimurium ST4 74
Length 160 aa, Gene pduK, UniProt E8XC00
>WP_001284387.1|Salmonella enterica Serovar Typhimurium ST4 74|propanediol utilization microcompartment protein PduK
MANKEHRVKQSLGLLEVCGLALAISCADIMAKSASITLLALEKTNGSGWMVIKITGDVASVQAAITTGAHFAEQRNGLVAHKVIARPGEGILLAETPSPSVIEPEPEASEIADVASEAPAEEAPQESELVSCNLCLDPKCPRQKGEPRTLCIHSGKRGEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,121,289 | 2.64 | 0.036 | ○○○○○ 1.55 | 1.54780803531847 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,121,289 | 1.34 | 0.54 | ○○○○○ 0.87 | 0.874375824698943 | 23637626 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)