Bacterial taxon 909946
Locus STM474_2134
Protein WP_000549824.1
propanediol utilization microcompartment protein PduN
Salmonella enterica Serovar Typhimurium ST4 74
Length 91 aa, Gene pduN, UniProt E8XC03
>WP_000549824.1|Salmonella enterica Serovar Typhimurium ST4 74|propanediol utilization microcompartment protein PduN
MHLARVTGAVVSTQKSPSLIGKKLLLVRRVSADGELPASPTSGDEVAVDSVGAGVGELVLLSGGSSARHVFSGPNEAIDLAVVGIVDTLSC
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,122,735 | 1.41 | 0.0034 | ○○○○○ 0.91 | 0.910969901628217 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,122,735 | 0.11 | 1 | ○○○○○ 0.23 | 0.232736697026783 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,122,735 | 0.81 | 0.5 | ○○○○○ 0.6 | 0.595267179507532 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)