Bacterial taxon 909946
Locus STM474_3835
Protein WP_001575119.1
protein bax
Salmonella enterica Serovar Typhimurium ST4 74
Length 274 aa, Gene bax, UniProt E8XFX7
>WP_001575119.1|Salmonella enterica Serovar Typhimurium ST4 74|protein bax
MILTPMRRYGAMILMLLTIAFSGEVLAKTHATQTSQKSHITETSYKQVSSKQEYSRNSAKSSSLPDLRKYPSGTPRKKAFLRTVMPYITSQNAAITADRNWLISKQYQNRWSPSERARMKDIAKRYKVSWSGNTRRIPWNTLLERVDIIPTSMVATMAAAESGWGTSKLARSNNNLFGMKCTKGRCTNTPGKVKGYSQFASVEESVSAYVANLNTHPAYSSFRKSRAQLRKADQEVTATAMIHKLKGYSTQGSRYNNYLFAMYQDNQRLIAAHM
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,871,379 | 1.56 | 0.013 | ○○○○○ 0.99 | 0.985220782692655 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,870,851 | 2.01 | 0.0056 | ○○○○○ 1.22 | 1.22204275123843 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,870,851 | -0.8 | 0.55 | ●○○○○ -0.24 | -0.240432963950292 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,871,379 | 0.94 | 0.75 | ○○○○○ 0.67 | 0.666177301692279 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,870,851 | 1.27 | 0.59 | ○○○○○ 0.84 | 0.835122529741953 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,871,379 | 2.04 | 0.37 | ○○○○○ 1.24 | 1.23799270319269 | 23637626 |
Retrieved 6 of 6 entries in 1.3 ms
(Link to these results)