Bacterial taxon 909946
Locus STM474_3540
Protein WP_001240053.1
protein-methionine-sulfoxide reductase heme-binding subunit MsrQ
Salmonella enterica Serovar Typhimurium ST4 74
Length 199 aa, Gene yedZ, UniProt E8XD83
>WP_001240053.1|Salmonella enterica Serovar Typhimurium ST4 74|protein-methionine-sulfoxide reductase heme-binding subunit MsrQ
MRLTAKQITWLKVCLHLAGFLPLLWLFWAINHGGLSADPVKDIQHFTGRTALKFLLATLLVSPLARYAKQPLLIRTRRLLGLWCFVWATLHLTSYALLELGIHNLALLGSELISRPYLTLGIISWLVLLALTLTSTQFAQRKLGKRWQTLHNVVYLVAILAPIHYLWSVKILSPQPVIYAALALALLALRYRKFRQWWR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,570,876 | 3.13 | 0.0046 | ○○○○○ 1.8 | 1.80100968667404 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,570,876 | 0.29 | 0.96 | ○○○○○ 0.33 | 0.329691447028252 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,570,876 | 0.82 | 0.71 | ○○○○○ 0.6 | 0.603684654211962 | 23637626 |
Retrieved 3 of 3 entries in 49.1 ms
(Link to these results)