Bacterial taxon 909946
Locus STM474_1853
Protein WP_000406918.1
PTS mannose/fructose/sorbose transporter subunit IIC
Salmonella enterica Serovar Typhimurium ST4 74
Length 266 aa, Gene manY, UniProt E8X8K2
>WP_000406918.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS mannose/fructose/sorbose transporter subunit IIC
MEITTLQIVLVFIVACIAGMESVLDEFQFHRPLIACTLIGAVLGDMKTGIIIGGTLEMIALGWMNIGAAVAPDAALASIISTVLVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAFQHAADKAAENGNLTALSWLHVSSLFLQAMRIAIPAVIVAISVGTSEVQGMLNAIPEVVTGGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGAVMAILYIQLSPKYNRVAGAPAAAAGNNDLDNELD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,887,534 | 1.2 | 0.021 | ○○○○○ 0.8 | 0.800691114566377 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,887,534 | 0.15 | 1 | ○○○○○ 0.25 | 0.252727816974511 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,887,534 | 0.94 | 0.65 | ○○○○○ 0.66 | 0.663563179916427 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)