Bacterial taxon 909946
Locus STM474_1317
Protein WP_000412161.1
PTS N,N'-diacetylchitobiose transporter subunit IIB
Salmonella enterica Serovar Typhimurium ST4 74
Length 106 aa, Gene celA, UniProt E8XGB9
Protein visualisation (by ProViz)
>WP_000412161.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS N,N'-diacetylchitobiose transporter subunit IIB
MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGPAADVVLLGPQIAYMLPEIQRLLPGKPVEVIDSMLYGKVDGLGVLKAAVAAIKKAAAN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,348,903 | -4.45 | 3.4e-21 | ●●●○○ -2.13 | -2.13443573628453 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,348,903 | -2.46 | 0.027 | ●●○○○ -1.1 | -1.09972200755521 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,348,930 | -2.29 | 0.00012 | ●●○○○ -1.01 | -1.01086290565429 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,348,930 | -1.48 | 0.005 | ●○○○○ -0.59 | -0.592679425304892 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,348,903 | -1.38 | 0.25 | ●○○○○ -0.54 | -0.539845783429026 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,348,930 | -1.22 | 0.47 | ●○○○○ -0.46 | -0.458434435696851 | 23637626 |
Retrieved 6 of 6 entries in 32.1 ms
(Link to these results)