Bacterial taxon 909946
Locus STM474_3958
Protein WP_001152234.1
PTS sugar transporter subunit IIA
Salmonella enterica Serovar Typhimurium ST4 74
Length 157 aa, Gene n/a, UniProt E8XGY1
>WP_001152234.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS sugar transporter subunit IIA
MQDIHFRRHYVRHLPKEVSQNDIIKALASPLINDGMVVSDFADHVITREQNFPTGLPVEPVGVAIPHTDHKYVRQNAISVGILAEPVNFEDMGGEPDPVPVRVVFMLALGESNKQLNVLGWIMDVIQDEDFMQQLLVMNDDEIYQSIYTRISERGEV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,005,701 | -5.81 | 5.6e-19 | ●●●○○ -2.84 | -2.84034503640969 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,005,701 | -4.02 | 0.00018 | ●●○○○ -1.91 | -1.91036830973371 | 23637626 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)