Bacterial taxon 909946
Locus STM474_1625
Protein WP_000976132.1
PTS sugar transporter subunit IIB
Salmonella enterica Serovar Typhimurium ST4 74
Length 93 aa, Gene n/a, UniProt E8XJU3
>WP_000976132.1|Salmonella enterica Serovar Typhimurium ST4 74|PTS sugar transporter subunit IIB
MMKKILVACGTGMSTSTMIAQKLQDFLAEQGIAATTAQCCLNEIPLNCNGMDLIVTSMRTHSDYGIPTLNGAALLTGINDDALKQEIKALLTQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,660,005 | -3.07 | 0.003 | ●●○○○ -1.42 | -1.41893923048912 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,660,005 | -1.66 | 0.001 | ●○○○○ -0.68 | -0.68440606833443 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,660,005 | 0.69 | 0.93 | ○○○○○ 0.53 | 0.534966317469861 | 23637626 |
Retrieved 3 of 3 entries in 402 ms
(Link to these results)