Bacterial taxon 909946
Locus STM474_0956
Protein WP_000067973.1
pyruvate formate lyase 1-activating protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 265 aa, Gene pflA, UniProt E8XCS6
>WP_000067973.1|Salmonella enterica Serovar Typhimurium ST4 74|pyruvate formate lyase 1-activating protein
MSNLTNCITNESVAVTADKKPVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEITVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLDVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAQYLSKKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,009,388 | -8.21 | 2.1e-9 | ●●●●● -4.08 | -4.08444439018895 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,009,271 | 2.08 | 0.01 | ○○○○○ 1.26 | 1.25663858664827 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,009,271 | 0.41 | 0.94 | ○○○○○ 0.39 | 0.391459748621285 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,009,271 | 0.48 | 0.71 | ○○○○○ 0.42 | 0.424338144291133 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,009,388 | 1.28 | 0.65 | ○○○○○ 0.84 | 0.841015997277052 | 23637626 |
Retrieved 5 of 5 entries in 1.6 ms
(Link to these results)