Bacterial taxon 909946
Locus STM474_2066
Protein WP_001241579.1
RusA family crossover junction endodeoxyribonuclease
Salmonella enterica Serovar Typhimurium ST4 74
Length 129 aa, Gene n/a, UniProt E8XB54
>WP_001241579.1|Salmonella enterica Serovar Typhimurium ST4 74|RusA family crossover junction endodeoxyribonuclease
MRLVLPFPPSVNTYWRAPNKGPLAGRHLISAVGRKYQSAACVAIIEQLRRLPKPSTELAAVEIILYPPDKRIRDLDNYNKALFDALTHAGVWEDDSQVKRMLVEWGPVFPKGKVEITITKFETGAGAAD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,067,614 | -3.97 | 5.9e-14 | ●●○○○ -1.89 | -1.88716650833864 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,067,608 | -1.4 | 0.018 | ●○○○○ -0.55 | -0.551948514820554 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,067,608 | -1.59 | 0.14 | ●○○○○ -0.65 | -0.651111411794314 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,067,608 | -1.23 | 0.47 | ●○○○○ -0.46 | -0.459535313839509 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,067,614 | -0.8 | 0.73 | ●○○○○ -0.24 | -0.237064816412141 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,067,614 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.162059456336155 | 23637626 |
Retrieved 6 of 6 entries in 3.1 ms
(Link to these results)