Bacterial taxon 909946
Locus STM474_2955
Protein WP_001130194.1
S-ribosylhomocysteine lyase
Salmonella enterica Serovar Typhimurium ST4 74
Length 171 aa, Gene luxS, UniProt E8XK61
>WP_001130194.1|Salmonella enterica Serovar Typhimurium ST4 74|S-ribosylhomocysteine lyase
MPLLDSFAVDHTRMQAPAVRVAKTMNTPHGDAITVFDLRFCIPNKEVMPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMADVLKVQDQNQIPELNVYQCGTYQMHSLSEAQDIARHILERDVRVNSNKELALPKEKLQELHI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,988,903 | 1.18 | 0.027 | ○○○○○ 0.79 | 0.789775766167393 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,988,903 | 1.1 | 0.45 | ○○○○○ 0.75 | 0.750157567450293 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,988,903 | 1.43 | 0.85 | ○○○○○ 0.92 | 0.918396910212435 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)