Bacterial taxon 909946
Locus STM474_1044
Protein WP_000334547.1
SOS response-associated peptidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 208 aa, Gene n/a, UniProt E8XDK7
>WP_000334547.1|Salmonella enterica Serovar Typhimurium ST4 74|SOS response-associated peptidase
MCGRFAQAQTREEYLAYLADEADRNIAYDPQPIGRYNVAPGTKVLLLSERDEQLHLDPVIWGYAPGWWDKAPLINARVATAASSRMFKPLWQHGRAICFADRWFEWKKEGDKKQPYFIHRKDGKPIFMAAIGSTPFERGDEAEGFLIVTSAADKGLVDIHDRRPLALTPETARVWMRQFLEPHSKSITYRVIPALTRPMMRKDTNPCQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,098,428 | -6.65 | 3.0e-8 | ●●●●○ -3.28 | -3.27876869225796 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,098,265 | -6.24 | 8.8e-23 | ●●●●○ -3.06 | -3.06333626005689 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,098,265 | -5.76 | 1.3e-5 | ●●●○○ -2.82 | -2.81605967809522 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,098,428 | -3.77 | 6.4e-13 | ●●○○○ -1.78 | -1.77818428343865 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,098,428 | -2.41 | 0.035 | ●●○○○ -1.08 | -1.07519900666925 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,098,265 | -1.69 | 0.22 | ●○○○○ -0.7 | -0.702965856160131 | 23637626 |
Retrieved 6 of 6 entries in 22.4 ms
(Link to these results)