Bacterial taxon 909946
Locus STM474_3016
Protein WP_000558928.1
SPI-1 type III secretion system invasion protein IagB
Salmonella enterica Serovar Typhimurium ST4 74
Length 160 aa, Gene iagB, UniProt E8XL05
>WP_000558928.1|Salmonella enterica Serovar Typhimurium ST4 74|SPI-1 type III secretion system invasion protein IagB
MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,044,567 | -3.19 | 0.00066 | ●●○○○ -1.48 | -1.47843180304983 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,044,567 | 0.03 | 1 | ○○○○○ 0.19 | 0.194782203516716 | 23637626 |
Retrieved 2 of 2 entries in 199.7 ms
(Link to these results)