Bacterial taxon 909946
Locus STM474_2811
Protein WP_001518569.1
SsrA-binding protein SmpB
Salmonella enterica Serovar Typhimurium ST4 74
Length 160 aa, Gene smpB, UniProt E8XIG5
>WP_001518569.1|Salmonella enterica Serovar Typhimurium ST4 74|SsrA-binding protein SmpB
MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,837,924 | -7.61 | 4.6e-9 | ●●●●○ -3.77 | -3.77260998475296 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,837,682 | -4.46 | 7.9e-5 | ●●●○○ -2.14 | -2.13873791705063 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,838,098 | -4.4 | 2.3e-16 | ●●●○○ -2.11 | -2.10952548656458 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,838,098 | -3.88 | 0.00042 | ●●○○○ -1.84 | -1.83686155473502 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,837,682 | -3.78 | 9.3e-10 | ●●○○○ -1.78 | -1.78423106773993 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,837,924 | -3.23 | 0.001 | ●●○○○ -1.5 | -1.49905007030619 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,837,682 | -1.95 | 9.6e-5 | ●○○○○ -0.83 | -0.834481758099072 | 23637626 |
Retrieved 7 of 7 entries in 1.4 ms
(Link to these results)