Bacterial taxon 909946
Locus STM474_2546
Protein WP_000881745.1
sulfate ABC transporter permease
Salmonella enterica Serovar Typhimurium ST4 74
Length 277 aa, Gene cysT, UniProt E8XFQ2
>WP_000881745.1|Salmonella enterica Serovar Typhimurium ST4 74|sulfate ABC transporter permease
MLAVSSRRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLSQMSWAQYWDVVTNPQVVAAYKVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAGLTLASLFSVNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEEAAQTLGATRLQSFRKVVLPELSPALIAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEFDYPAASAIASVILAASLLLLFSINTLQSRFGRRVVGH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,552,981 | -3.14 | 0.016 | ●●○○○ -1.45 | -1.45395554620134 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,552,719 | -1.02 | 0.53 | ●○○○○ -0.35 | -0.35278234086212 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,552,719 | -0.72 | 0.18 | ●○○○○ -0.2 | -0.197484585833026 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,552,981 | -0.63 | 0.37 | ●○○○○ -0.15 | -0.15015560834931 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,552,981 | -0.09 | 0.98 | ○○○○○ 0.13 | 0.128927722845957 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,552,719 | 0.11 | 1 | ○○○○○ 0.23 | 0.234709709198374 | 23637626 |
Retrieved 6 of 6 entries in 2.8 ms
(Link to these results)