Bacterial taxon 909946
Locus STM474_1035
Protein WP_000877926.1
superoxide dismutase [Cu-Zn]
Salmonella enterica Serovar Typhimurium ST4 74
Length 177 aa, Gene sodC1, UniProt E8XDJ8
>WP_000877926.1|Salmonella enterica Serovar Typhimurium ST4 74|superoxide dismutase [Cu-Zn]
MKYTILSLVAGALISCSAMAENTLTVKMNDALSSGTGENIGEITVSETPYGLLFTPHLNGLTPGIHGFHVHTNPSCMPGMKDGKEVPALMAGGHLDPEKTGKHLGPYNDKGHLGDLPGLVVNADGTATYPLLAPRLKSLSELKGHSLMIHKGGDNYSDKPAPLGGGGARFACGVIEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,086,701 | -3.02 | 3.0e-9 | ●●○○○ -1.39 | -1.39168363344379 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,086,701 | 0.28 | 0.97 | ○○○○○ 0.32 | 0.320023312390296 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,086,701 | 1.98 | 0.4 | ○○○○○ 1.21 | 1.20765189529147 | 23637626 |
Retrieved 3 of 3 entries in 10.8 ms
(Link to these results)