Bacterial taxon 909946
Locus STM474_2709
Protein WP_000677089.1
tail protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 192 aa, Gene n/a, UniProt E8XHI2
>WP_000677089.1|Salmonella enterica Serovar Typhimurium ST4 74|tail protein
MKGLENAIRNLNSLDRQMVPRASIWAVNRVAQKAVSVATRKVARETVAGDNQVRGLPLKLVRQRVRLFKAGTDGKRSARIRINRGNLPAIKLGAAQVRMSKRRGKLLYRGSVLKIGPYLFRDAFIQQLANGRWHVMRRVNGKNRYPIDVVKIPLSGPLTQAFESATQSLIDEEIPKQLGYALKQQLRLYLSR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,747,702 | 1.99 | 0.0066 | ○○○○○ 1.21 | 1.20895451214366 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,747,702 | 1.19 | 0.42 | ○○○○○ 0.8 | 0.79507963180966 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,747,702 | 1.42 | 0.5 | ○○○○○ 0.91 | 0.912351261133135 | 23637626 |
Retrieved 3 of 3 entries in 2.2 ms
(Link to these results)