Bacterial taxon 909946
Locus STM474_4134
Protein WP_001277136.1
thioesterase family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 155 aa, Gene n/a, UniProt E8XJE4
>WP_001277136.1|Salmonella enterica Serovar Typhimurium ST4 74|thioesterase family protein
MSAVLTAEQALKLVGEMFVYHMPFNRALGLELERYEKAFAQLAFNNQPMMVGNWAQSILHGGVIASALDVAAGLVCVGSTLTRHETISEDELRQRLSRMGTIDLRVDYLRPGRGNRFTATSSLLRAGNKVAVARVELHNEDQLYIASATATYMVG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,182,807 | 2.05 | 0.00012 | ○○○○○ 1.24 | 1.24179922506062 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,182,807 | 0.37 | 0.94 | ○○○○○ 0.37 | 0.370235337740236 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,182,807 | 1.59 | 0.34 | ○○○○○ 1 | 1.00453697422277 | 23637626 |
Retrieved 3 of 3 entries in 2.4 ms
(Link to these results)