Bacterial taxon 909946
Locus STM474_4093
Protein WP_001280776.1
thioredoxin TrxA
Salmonella enterica Serovar Typhimurium ST4 74
Length 109 aa, Gene trxA, UniProt E8XIM6
>WP_001280776.1|Salmonella enterica Serovar Typhimurium ST4 74|thioredoxin TrxA
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,146,670 | -8.21 | 4.4e-10 | ●●●●● -4.08 | -4.08444439018895 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,146,552 | -8.06 | 5.2e-30 | ●●●●● -4.01 | -4.00771841153506 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,146,670 | -7.49 | 7.1e-10 | ●●●●○ -3.71 | -3.71120090353972 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,146,552 | -6.86 | 1.0e-6 | ●●●●○ -3.38 | -3.38389234645267 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,146,670 | -6.12 | 4.5e-20 | ●●●●○ -3 | -3.00305578268002 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,146,450 | -5.43 | 1.0e-6 | ●●●○○ -2.64 | -2.64225648100681 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,146,552 | -5.22 | 2.3e-6 | ●●●○○ -2.54 | -2.53516378739815 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,146,450 | -2.74 | 0.00012 | ●●○○○ -1.25 | -1.24509198356801 | 23637626 |
Retrieved 8 of 8 entries in 1.3 ms
(Link to these results)