Bacterial taxon 909946
Locus STM474_3520
Protein WP_001257852.1
transcriptional regulator ArgR
Salmonella enterica Serovar Typhimurium ST4 74
Length 156 aa, Gene argR, UniProt E8XD63
>WP_001257852.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator ArgR
MRSSAKQEELVRAFKALLKEEKFSSQGEIVLALQDQGFENINQSKVSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPASGFSVRDLYEAILELFEQEL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,549,581 | -5.6 | 5.8e-7 | ●●●○○ -2.73 | -2.72847435134543 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,549,581 | -3.85 | 2.5e-13 | ●●○○○ -1.82 | -1.82298571929703 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,549,581 | -3 | 0.0063 | ●●○○○ -1.38 | -1.37939881473114 | 23637626 |
Retrieved 3 of 3 entries in 21.4 ms
(Link to these results)