Bacterial taxon 909946
Locus STM474_0467
Protein WP_000973433.1
transcriptional regulator BolA
Salmonella enterica Serovar Typhimurium ST4 74
Length 105 aa, Gene bolA, UniProt E8XKN4
>WP_000973433.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator BolA
MMIREQIEEKLRTAFDPVFLEVVDESYRHNVPAGSESHFKVVLVSDRFTGERFLNRHRMIYGTLTAELSTTVHALALHTYTLKEWEGLQDTIFASPPCRGAGSIA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 500,695 | -2.22 | 0.042 | ●○○○○ -0.98 | -0.978265762529062 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 500,695 | 0.46 | 0.46 | ○○○○○ 0.42 | 0.415732316214142 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 500,695 | 1.37 | 0.52 | ○○○○○ 0.89 | 0.889453250541648 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)