Bacterial taxon 909946
Locus STM474_4255
Protein WP_001283048.1
transcriptional regulator LsrR
Salmonella enterica Serovar Typhimurium ST4 74
Length 319 aa, Gene ydeW, UniProt E8XKE0
>WP_001283048.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator LsrR
MSDNTLVSDYGMCEEEQVARIAWFYYHDGLTQSEISERLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYENALRNHFALQNIRVLPALPDADIGLRLGIGAAHMLMESLRPQQLLAVGFGEATMTTLKRLSGFISAQQIRLVTLSGGVGPYMTGIGQLDAACSVSIMPAPLRASSQEIACTLRNENSVRDVMLTAQAADAAIVGIGAINQKDQASILKSGYITQGEQLMIGRKGAVGDILGYFFDAHGEIIPDIKIHNELIGLKLNSLSTIPTVIGVAGGEQKAEAIIAAMRGNYINALVTDQKTAGKIIQIIEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,304,553 | -3.21 | 0.0031 | ●●○○○ -1.49 | -1.48793021109569 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,304,563 | -2.95 | 3.9e-6 | ●●○○○ -1.35 | -1.35498106128271 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,304,553 | -2.77 | 2.0e-9 | ●●○○○ -1.26 | -1.26168256372178 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,304,553 | -2.27 | 0.012 | ●●○○○ -1 | -1.00075864947382 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,304,563 | -2.22 | 0.055 | ●○○○○ -0.98 | -0.976093033340155 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,304,002 | -1.43 | 0.39 | ●○○○○ -0.57 | -0.56707863085431 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,303,772 | -1.06 | 0.41 | ●○○○○ -0.37 | -0.371372748003168 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,304,154 | -1.02 | 0.12 | ●○○○○ -0.35 | -0.352878202724674 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,303,772 | -0.95 | 0.78 | ●○○○○ -0.32 | -0.31560033319479 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,304,154 | -0.89 | 0.68 | ●○○○○ -0.29 | -0.285478535372147 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,304,154 | -0.5 | 0.76 | ●○○○○ -0.08 | -0.0849436300848977 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,304,002 | -0.49 | 0.7 | ●○○○○ -0.08 | -0.0765301473527389 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,304,563 | 0.05 | 0.9 | ○○○○○ 0.2 | 0.202806218902394 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,304,002 | 0.74 | 0.33 | ○○○○○ 0.56 | 0.563479734240794 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,303,772 | 0.93 | 0.26 | ○○○○○ 0.66 | 0.661293615149861 | 23637626 |
Retrieved 15 of 15 entries in 13.4 ms
(Link to these results)