Bacterial taxon 909946
Locus STM474_2366
Protein WP_001061919.1
transcriptional regulator RcsB
Salmonella enterica Serovar Typhimurium ST4 74
Length 216 aa, Gene rcsB, UniProt E8XEB2
>WP_001061919.1|Salmonella enterica Serovar Typhimurium ST4 74|transcriptional regulator RcsB
MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPTDKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,368,242 | -2.15 | 2.2e-5 | ●○○○○ -0.94 | -0.940887514656483 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,368,242 | -0.03 | 0.89 | ○○○○○ 0.16 | 0.161538631965843 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,368,242 | 0.93 | 1 | ○○○○○ 0.66 | 0.660824124001231 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)