Bacterial taxon 909946
Locus STM474_0380
Protein WP_000433131.1
transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 210 aa, Gene yahN, UniProt E8XJR4
>WP_000433131.1|Salmonella enterica Serovar Typhimurium ST4 74|transporter
MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITGLGVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMSTLQTPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSSVIWRIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGVTHR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 414,803 | -6.54 | 1.8e-25 | ●●●●○ -3.22 | -3.21936926969833 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 414,843 | -5.23 | 0.0011 | ●●●○○ -2.54 | -2.53820694414781 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 414,803 | -2.64 | 0.069 | ●●○○○ -1.19 | -1.19246654015751 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 414,843 | -2.22 | 0.056 | ●○○○○ -0.98 | -0.97818152344931 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 414,803 | -0.18 | 0.95 | ○○○○○ 0.08 | 0.0843117311590572 | 23637626 |
Retrieved 5 of 5 entries in 1.2 ms
(Link to these results)