Bacterial taxon 909946
Locus STM474_3825
Protein WP_001541099.1
transposase
Salmonella enterica Serovar Typhimurium ST4 74
Length 63 aa, Gene n/a, UniProt E8XFW8
Protein visualisation (by ProViz)
>WP_001541099.1|Salmonella enterica Serovar Typhimurium ST4 74|transposase
MSRKGNCLDNACAECFFGTLKSESFYTSKFKDIDELKIAIEDYIRYYNTRRISLKFNGLSPVE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,860,644 | -4.07 | 8.6e-6 | ●●○○○ -1.94 | -1.93825395290245 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,860,644 | -3.51 | 0.00071 | ●●○○○ -1.65 | -1.6474859386672 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,860,644 | -2.27 | 0.00016 | ●●○○○ -1 | -1.00034773806451 | 23637626 |
Retrieved 3 of 3 entries in 16.1 ms
(Link to these results)