Bacterial taxon 909946
Locus STM474_3929
Protein WP_000015517.1
transposase
Salmonella enterica Serovar Typhimurium ST4 74
Length 57 aa, Gene rhuM, UniProt E8XGV3
>WP_000015517.1|Salmonella enterica Serovar Typhimurium ST4 74|transposase
MSGKRYPEEFIIKAVKQVIERGHSVSSVATRLDITTHSLYAWIKPPYSRRYHAITGV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,974,278 | -2.56 | 3.6e-7 | ●●○○○ -1.15 | -1.15188798414917 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,974,278 | -1.62 | 0.15 | ●○○○○ -0.66 | -0.663705897875937 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,974,278 | -1.08 | 0.73 | ●○○○○ -0.38 | -0.382993530405191 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)